PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000310981
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 377aa    MW: 41963.3 Da    PI: 8.0763
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000310981genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.81.4e-55161441129
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                    lppGfrFhPtdeel+++yL kkv +++++  ++i+evd++k+ePw+Lp k+k +ekewyfFs rd+ky+tg r+nrat++gyWkatgkd+e++s+ 
  MDP0000310981  16 LPPGFRFHPTDEELITYYLLKKVLDSSFTG-RAIAEVDLNKCEPWELPDKAKMGEKEWYFFSLRDRKYPTGLRTNRATEAGYWKATGKDREIYSSk 110
                    79*************************999.89***************99999****************************************974 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                    + +lvg+kktLvfy+grapkgek++Wvmheyrle
  MDP0000310981 111 TCALVGMKKTLVFYRGRAPKGEKSNWVMHEYRLE 144
                    5567****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-618153IPR003441NAC domain
PROSITE profilePS5100557.38816200IPR003441NAC domain
PfamPF023659.7E-2917143IPR003441NAC domain
SuperFamilySSF1019413.92E-61188200IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0010160Biological Processformation of organ boundary
GO:0010223Biological Processsecondary shoot formation
GO:0048366Biological Processleaf development
GO:0048504Biological Processregulation of timing of organ formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MDIMSFSTHF DHNTHLPPGF RFHPTDEELI TYYLLKKVLD SSFTGRAIAE VDLNKCEPWE  60
LPDKAKMGEK EWYFFSLRDR KYPTGLRTNR ATEAGYWKAT GKDREIYSSK TCALVGMKKT  120
LVFYRGRAPK GEKSNWVMHE YRLEGKFAYH YLSRSSKERH HLPTGLIFLK KLTGFFSNFA  180
YGIDSIHVQD EWVISRVFQK SSGSAANGPG SKKTRMGNGS TSSVSLYPEP SSPSSVSLPP  240
LLDSSPYQPI SAAGDGCSYD SPIPREHVSC FSTNPSNNGF NLPASCFDLA HPPPPQPPNF  300
GGVSAFPSLR SLQENLQLPF FFSPMPAHPP VHVGSSVAGG GSSVDFTGNW PPVSEEARAV  360
GPTELDCMWN YYKTECL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B7e-491614317142NAC domain-containing protein 19
4dul_A7e-491614317142NAC domain-containing protein 19
1ut7_B7e-491614317142NO APICAL MERISTEM PROTEIN
1ut7_A7e-491614317142NO APICAL MERISTEM PROTEIN
1ut4_B7e-491614317142NO APICAL MERISTEM PROTEIN
1ut4_A7e-491614317142NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00562DAPTransfer from AT5G53950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009340641.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 2
SwissprotO040171e-109NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLM5X6640.0M5X664_PRUPE; Uncharacterized protein
STRINGGLYMA13G34950.11e-142(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36893463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.11e-101NAC family protein